Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A28 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SLC25A28 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15956720
|
Novus Biologicals
NBP15956720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159567
|
Novus Biologicals
NBP159567 |
100 μL |
Each for $487.50
|
|
|||||
Description
SLC25A28 Polyclonal specifically detects SLC25A28 in Human samples. It is validated for Western Blot.Specifications
| SLC25A28 | |
| Polyclonal | |
| Rabbit | |
| Q96A46 | |
| 81894 | |
| Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the middle region of SLC25A28. Peptide sequence VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28 | |
| SLC25A28 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title