Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A28 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159562 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159562 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159562 Supplier Novus Biologicals Supplier No. NBP159562
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC25A28 Polyclonal specifically detects SLC25A28 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A28
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96A46
Gene Alias DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28
Gene Symbols SLC25A28
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the C terminal of SLC25A28. Peptide sequence NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81894
Test Specificity Expected identity based on immunogen sequence: Chicken: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.