Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC25A29 Antibody, Novus Biologicals™

SLC25A29 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159499 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159499 100 μL
NBP15949920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159499 Supplier Novus Biologicals Supplier No. NBP159499
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC25A29 Polyclonal specifically detects SLC25A29 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC25A29
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N8R3
Gene Alias C14orf69, CACL, CACT-like, carnitine-acylcarnitine translocase like, chromosome 14 open reading frame 69, FLJ38975, mitochondrial carnitine/acylcarnitine carrier protein CACL, Solute carrier family 25 member 29, solute carrier family 25, member 29
Gene Symbols SLC25A29
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A29(solute carrier family 25, member 29) The peptide sequence was selected from the C terminal of SLC25A29. Peptide sequence AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 123096
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.