SLC25A31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18907425UL

Catalog No. NB430937

Description

SLC25A31 Polyclonal specifically detects SLC25A31 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A31
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: AAC4DKFZp434N1235, adenine nucleotide translocase 4, Adenine nucleotide translocator 4, ADP, ADP/ATP translocase 4, ANT 4, ANT4DKFZP434N1235, ATP carrier protein 4, SFEC, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83447
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC25A31
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only