Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A32 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15956620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15956620 20 μL
NBP159566 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15956620 Supplier Novus Biologicals Supplier No. NBP15956620UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

SLC25A32 Polyclonal specifically detects SLC25A32 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC25A32
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H2D1
Gene Alias MFTCMFTFLJ23872, mitochondrial folate transporter/carrier, Solute carrier family 25 member 32, solute carrier family 25, member 32
Gene Symbols SLC25A32
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81034
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.