Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15956620UL
Description
SLC25A32 Polyclonal specifically detects SLC25A32 in Human samples. It is validated for Western Blot.Specifications
| SLC25A32 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| Q9H2D1 | |
| SLC25A32 | |
| Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID. | |
| Affinity Purified | |
| RUO | |
| 81034 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MFTCMFTFLJ23872, mitochondrial folate transporter/carrier, Solute carrier family 25 member 32, solute carrier family 25, member 32 | |
| Rabbit | |
| 35 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction