Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A32 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | SLC25A32 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15956620
|
Novus Biologicals
NBP15956620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159566
|
Novus Biologicals
NBP159566 |
100 μL |
Each for $499.50
|
|
|||||
Description
SLC25A32 Polyclonal specifically detects SLC25A32 in Human samples. It is validated for Western Blot.Specifications
| SLC25A32 | |
| Polyclonal | |
| Rabbit | |
| Q9H2D1 | |
| 81034 | |
| Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MFTCMFTFLJ23872, mitochondrial folate transporter/carrier, Solute carrier family 25 member 32, solute carrier family 25, member 32 | |
| SLC25A32 | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title