Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SLC25A35
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin
Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB438587 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP21332425UL	25ul	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP213324 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP213324	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SLC25A35 Polyclonal specifically detects SLC25A35 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	SLC25A35
Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	399512
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	FLJ40217, MGC120446, MGC120448, solute carrier family 25 member 35, solute carrier family 25, member 35
Gene Symbols	SLC25A35
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SLC25A35 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents