Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A39 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159600 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159600 100 μL
NBP15960020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159600 Supplier Novus Biologicals Supplier No. NBP159600
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A39
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BZJ4
Gene Alias CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39
Gene Symbols SLC25A39
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51629
Test Specificity Zebrafish 85%.
Reconstitution Reconstitute with 50μL of distilled water. Final anti-SLC25A39 antibody concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.