SLC25A39 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159600

Catalog No. NBP159600

Description

SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A39
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
• Gene Accession No.: Q9BZJ4
• Gene Symbols: SLC25A39
• Immunogen: Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51629
• Reconstitution: Reconstitute with 50μL of distilled water. Final anti-SLC25A39 antibody concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.