Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15960020UL
Description
SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC25A39 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4.0-8.0 ug/ml | |
| Q9BZJ4 | |
| SLC25A39 | |
| Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF. | |
| Affinity Purified | |
| RUO | |
| 51629 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39 | |
| Rabbit | |
| 39 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
missing translation for 'provideContentCorrection'
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'
Spot an opportunity for improvement?
missing translation for 'provideContentCorrection'