Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15987620UL
Description
SLC25A45 Polyclonal specifically detects SLC25A45 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC25A45 | |
| Polyclonal | |
| Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q8N413-2 | |
| SLC25A45 | |
| Synthetic peptides corresponding to LOC283130 The peptide sequence was selected from the C terminal of LOC283130. Peptide sequence GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. | |
| 20 μL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| solute carrier family 25 member 45, solute carrier family 25, member 45 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 283130 | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction