Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC25A46 Antibody, Novus Biologicals™

SLC25A46 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15956520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15956520 20 μL
NBP159565 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15956520 Supplier Novus Biologicals Supplier No. NBP15956520UL

Description

Rabbit Polyclonal Antibody

SLC25A46 Polyclonal specifically detects SLC25A46 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A46
Applications Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry-Paraffin
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96AG3
Gene Alias solute carrier family 25 member 46, solute carrier family 25, member 46, TB1
Gene Symbols SLC25A46
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A46(solute carrier family 25, member 46) The peptide sequence was selected from the N terminal of SLC25A46. Peptide sequence RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 91137
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.