Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179515
Description
SLC25A48 Polyclonal specifically detects SLC25A48 in Human samples. It is validated for Western Blot.Specifications
SLC25A48 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ44862, HCC-down-regulated mitochondrial carrier protein, HDMCP, solute carrier family 25 member 48, solute carrier family 25, member 48 | |
Rabbit | |
31 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
BAC86705 | |
SLC25A48 | |
Synthetic peptide directed towards the c terminal of human LOC153328. Peptide sequence TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ. | |
Affinity purified | |
RUO | |
153328 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction