Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	SLC25A48
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179515 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179515	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP17951520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17951520UL	20 μL	N/A		N/A	N/A

Description

SLC25A48 Polyclonal specifically detects SLC25A48 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SLC25A48
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	FLJ44862, HCC-down-regulated mitochondrial carrier protein, HDMCP, solute carrier family 25 member 48, solute carrier family 25, member 48
Gene Symbols	SLC25A48
Isotype	IgG
Molecular Weight of Antigen	31 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	BAC86705
Gene ID (Entrez)	153328
Immunogen	Synthetic peptide directed towards the c terminal of human LOC153328. Peptide sequence TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SLC25A48 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents