Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC26A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18052220UL
Description
SLC26A2 Polyclonal specifically detects SLC26A2 in Mouse samples. It is validated for Western Blot.Specifications
| SLC26A2 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_031911 | |
| SLC26A2 | |
| Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA. | |
| 20 μL | |
| Primary | |
| Mouse | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1836 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction