Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC26A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	SLC26A2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18052220 View Documents View Product Certificates	Novus Biologicals NBP18052220UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180522 View Documents View Product Certificates	Novus Biologicals NBP180522	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SLC26A2 Polyclonal specifically detects SLC26A2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	SLC26A2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_031911
Gene ID (Entrez)	1836
Immunogen	Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter
Gene Symbols	SLC26A2
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SLC26A2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents