SLC2A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31711425UL

Catalog No. NB169305

Description

SLC2A13 Polyclonal antibody specifically detects SLC2A13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLC2A13
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: H(+)-myo-inositol cotransporter, H(+)-myo-inositol symporter, Hmit, HMITproton (H+) myo-inositol symporter, MGC48624, proton myo-inositol cotransporter, solute carrier family 2 (facilitated glucose transporter), member 13
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP
• Quantity: 25 μg
• Research Discipline: Alzheimers Research, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 114134
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified