Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC2A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$366.50 - $609.50
Specifications
| Antigen | SLC2A13 |
|---|---|
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLC2A13 Polyclonal antibody specifically detects SLC2A13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SLC2A13 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 114134 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| H(+)-myo-inositol cotransporter, H(+)-myo-inositol symporter, Hmit, HMITproton (H+) myo-inositol symporter, MGC48624, proton myo-inositol cotransporter, solute carrier family 2 (facilitated glucose transporter), member 13 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title