SLC35B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169299

Catalog No. NBP169299

Description

SLC35B1 Polyclonal specifically detects SLC35B1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC35B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hUGTrel1, solute carrier family 35, member B1, UDP-galactose transporter related, UDP-galactose transporter-related protein 1, UGTrel1, UGTREL1solute carrier family 35 member B1
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P78383
• Gene Symbols: SLC35B1
• Immunogen: Synthetic peptides corresponding to SLC35B1(solute carrier family 35, member B1) The peptide sequence was selected from the C terminal of SLC35B1. Peptide sequence ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10237
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only