SLC35C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159386

Catalog No. NBP159386

Description

SLC35C1 Polyclonal specifically detects SLC35C1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC35C1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CDG2C, FLJ11320, FLJ14841, FUCT1GDP-fucose transporter 1, Solute carrier family 35 member C1, solute carrier family 35, member C1
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Human: 100%; Rabbit: 100%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96A29
• Gene Symbols: SLC35C1
• Immunogen: Synthetic peptides corresponding to SLC35C1(solute carrier family 35, member C1) The peptide sequence was selected from the N terminal of SLC35C1. Peptide sequence TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55343
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only