SLC38A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159649

Catalog No. NBP159649

Description

SLC38A1 Polyclonal specifically detects SLC38A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC38A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Amino acid transporter A1, ATA1SNAT1, NAT2N-system amino acid transporter 2, SAT1amino acid transporter system A1, sodium-coupled neutral amino acid transporter 1, Solute carrier family 38 member 1, solute carrier family 38, member 1, System A amino acid transporter 1, System N amino acid transporter 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Bovine 85%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9H2H9
• Gene Symbols: SLC38A1
• Immunogen: Synthetic peptides corresponding to SLC38A1(solute carrier family 38, member 1) The peptide sequence was selected from the middle region of SLC38A1. Peptide sequence LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81539
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only