Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC38A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18887225UL
Description
SLC38A2 Polyclonal specifically detects SLC38A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC38A2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Amino acid transporter A2, ata2, ATA2System A transporter 1, KIAA1382System N amino acid transporter 2, pro1068, Protein 40-9-1, sat2, SAT2PRO1068, snat2, SNAT2amino acid transporter 2, sodium-coupled neutral amino acid transporter 2, Solute carrier family 38 member 2, solute carrier family 38, member 2, System A amino acid transporter 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
54407 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SLC38A2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction