SLC38A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188872

Catalog No. NBP188872

Description

SLC38A2 Polyclonal specifically detects SLC38A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC38A2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Amino acid transporter A2, ata2, ATA2System A transporter 1, KIAA1382System N amino acid transporter 2, pro1068, Protein 40-9-1, sat2, SAT2PRO1068, snat2, SNAT2amino acid transporter 2, sodium-coupled neutral amino acid transporter 2, Solute carrier family 38 member 2, solute carrier family 38, member 2, System A amino acid transporter 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54407
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC38A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only