SLC38A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16010320UL

Catalog No. NBP16010320

Description

SLC38A3 Polyclonal specifically detects SLC38A3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC38A3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry
• Gene Accession No.: Q99624
• Gene Symbols: SLC38A3
• Immunogen: Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10991
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG