Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC38A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
| Antigen | SLC38A3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16010320
|
Novus Biologicals
NBP16010320UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP160103
|
Novus Biologicals
NBP160103 |
100 μL |
Each for $499.50
|
|
|||||
Description
SLC38A3 Polyclonal specifically detects SLC38A3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| SLC38A3 | |
| Unconjugated | |
| RUO | |
| G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1 | |
| SLC38A3 | |
| IgG | |
| 56 kDa |
| Polyclonal | |
| Rabbit | |
| Q99624 | |
| 10991 | |
| Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title