SLC39A10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23830625UL

Catalog No. NB436250

Description

SLC39A10 Polyclonal specifically detects SLC39A10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC39A10
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9ULF5
• Gene Symbols: SLC39A10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp564L2123, DKFZp781L10106, FLJ90515, KIAA1265, LZT-Hs2, MGC126565, MGC138428, solute carrier family 39 (metal ion transporter), member 10, solute carrier family 39 (zinc transporter), member 10, Solute carrier family 39 member 10, zinc transporter ZIP10, ZIP10, ZIP-10, Zrt- and Irt-like protein 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57181
• Target Species: Human
• Isotype: IgG