Learn More
Description
Specifications
Specifications
| Antigen | SLC5A8/SMCT1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | AITSolute carrier family 5 member 8, Apical iodide transporter, Electrogenic sodium monocarboxylate cotransporter, MGC125354, SMCTSMCT1, Sodium iodide-related cotransporter, sodium-coupled monocarboxylate transporter 1, solute carrier family 5 (iodide transporter), member 8 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC5A8/SMCT1. Peptide sequence CNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGT |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
