SLC5A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159873

Catalog No. NBP159873

Description

SLC5A9 Polyclonal specifically detects SLC5A9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC5A9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SLC5A9
• Immunogen: Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter), member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 85%.
• Target Species: Human, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: hSGLT4, MGC132523, Na(+)/glucose cotransporter 4, SGLT4MGC132517, sodium/glucose cotransporter 4, solute carrier family 5 (sodium/glucose cotransporter), member 9, Solute carrier family 5 member 9
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200010
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.