Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC5A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15987320UL
Description
SLC5A9 Polyclonal specifically detects SLC5A9 in Human samples. It is validated for Western Blot.Specifications
| SLC5A9 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| hSGLT4, MGC132523, Na(+)/glucose cotransporter 4, SGLT4MGC132517, sodium/glucose cotransporter 4, solute carrier family 5 (sodium/glucose cotransporter), member 9, Solute carrier family 5 member 9 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 200010 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| SLC5A9 | |
| Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter), member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFV | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction