Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC6A18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | SLC6A18 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159903
|
Novus Biologicals
NBP159903 |
100 μL | N/A | N/A | N/A | ||||
Description
SLC6A18 Polyclonal specifically detects SLC6A18 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC6A18 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ31236, Sodium- and chloride-dependent transporter XTRP2, sodium channel-like protein, sodium-dependent neutral amino acid transporter B(0)AT3, solute carrier family 6 (neurotransmitter transporter), member 18, Solute carrier family 6 member 18, solute carrier family 6, member 18, System B(0) neutral amino acid transporter AT3, XTRP2 | |
| SLC6A18 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q96N87 | |
| 348932 | |
| Synthetic peptides corresponding to SLC6A18(solute carrier family 6, member 18) The peptide sequence was selected from the middle region of SLC6A18. Peptide sequence MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title