Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC6A3/DAT1 Antibody (CL3123), Novus Biologicals™
SDP

Catalog No. NB396370 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396370 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396370 Supplier Novus Biologicals Supplier No. NBP24664925UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

SLC6A3/DAT1 Monoclonal antibody specifically detects SLC6A3/DAT1 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen SLC6A3/DAT1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3123
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. Q01959
Gene Alias DA transporter, DATDAT1Solute carrier family 6 member 3, sodium-dependent dopamine transporter, solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHYLFSSFTTELPWNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6531
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.