Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC7A5/LAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB124877 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB124877 100 μg
NB124878 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB124877 Supplier Novus Biologicals Supplier No. NBP309988100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC7A5/LAT1 Polyclonal specifically detects SLC7A5/LAT1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen SLC7A5/LAT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias 4F2 LC, CD98, CD98LC, D16S469EL-type amino acid transporter 1, E16, Integral membrane protein E16, large neutral amino acids transporter 1, large neutral amino acids transporter small subunit 1, LAT1hLAT1, MPE16CD98 light chain, sodium-independent neutral amino acid transporter LAT1,4F2LC, solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain, Solute carrier family 7 member 5, y+ system cationic amino acid transporter
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 8140
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.