SLC7A5/LAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP30998825UL

Catalog No. NB124878

Description

SLC7A5/LAT1 Polyclonal specifically detects SLC7A5/LAT1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SLC7A5/LAT1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 4F2 LC, CD98, CD98LC, D16S469EL-type amino acid transporter 1, E16, Integral membrane protein E16, large neutral amino acids transporter 1, large neutral amino acids transporter small subunit 1, LAT1hLAT1, MPE16CD98 light chain, sodium-independent neutral amino acid transporter LAT1,4F2LC, solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain, Solute carrier family 7 member 5, y+ system cationic amino acid transporter
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC
• Quantity: 25 μg
• Research Discipline: Cancer
• Gene ID (Entrez): 8140
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified