SLC7A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24931925UL

Catalog No. NB395744

Description

SLC7A8 Polyclonal antibody specifically detects SLC7A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLC7A8
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: hLAT2, integral membrane protein E16H, large neutral amino acids transporter small subunit 2, LAT2L-type amino acid transporter 2, LPI-PC1, solute carrier family 7 (amino acid transporter, L-type), member 8, Solute carrier family 7 member 8, y+ system), member 8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
• Quantity: 25 μL
• Research Discipline: Amino Acids Drugs and other smAll species molecules, Cancer, Endocrinology, Neuroscience, Signal Transduction
• Gene ID (Entrez): 23428
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified