Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC7A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | SLC7A8 |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SLC7A8 Polyclonal antibody specifically detects SLC7A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SLC7A8 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Amino Acids Drugs and other smAll species molecules, Cancer, Endocrinology, Neuroscience, Signal Transduction | |
PBS (pH 7.2), 40% Glycerol | |
23428 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
hLAT2, integral membrane protein E16H, large neutral amino acids transporter small subunit 2, LAT2L-type amino acid transporter 2, LPI-PC1, solute carrier family 7 (amino acid transporter, L-type), member 8, Solute carrier family 7 member 8, y+ system), member 8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title