Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLCO1C1 Antibody, Novus Biologicals™

SLCO1C1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15964220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15964220 20 μL
NBP159642 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15964220 Supplier Novus Biologicals Supplier No. NBP15964220UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

SLCO1C1 Polyclonal specifically detects SLCO1C1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLCO1C1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NYB5
Gene Alias OATP1, OATP14Thyroxine transporter, OATP1C1Solute carrier family 21 member 14, OATPFOAT-RP-5, OATP-FOrganic anion-transporting polypeptide 14, OATPRP5, Organic anion transporter F, Organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, SLC21A14OATP-14, solute carrier family 21 (organic anion transporter), member 14, solute carrier organic anion transporter family member 1C1, solute carrier organic anion transporter family, member 1C1
Gene Symbols SLCO1C1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLCO1C1(solute carrier organic anion transporter family, member 1C1) The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ.
Molecular Weight of Antigen 79 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 53919
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.