Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLCO1C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15964220UL
Description
SLCO1C1 Polyclonal specifically detects SLCO1C1 in Human samples. It is validated for Western Blot.Specifications
SLCO1C1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9NYB5 | |
SLCO1C1 | |
Synthetic peptides corresponding to SLCO1C1(solute carrier organic anion transporter family, member 1C1) The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ. | |
Affinity Purified | |
RUO | |
53919 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
OATP1, OATP14Thyroxine transporter, OATP1C1Solute carrier family 21 member 14, OATPFOAT-RP-5, OATP-FOrganic anion-transporting polypeptide 14, OATPRP5, Organic anion transporter F, Organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, SLC21A14OATP-14, solute carrier family 21 (organic anion transporter), member 14, solute carrier organic anion transporter family member 1C1, solute carrier organic anion transporter family, member 1C1 | |
Rabbit | |
79 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction