Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLCO2B1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159811 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159811 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159811 Supplier Novus Biologicals Supplier No. NBP159811
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLCO2B1 Polyclonal specifically detects SLCO2B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SLCO2B1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O94956
Gene Alias OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1
Gene Symbols SLCO2B1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ.
Molecular Weight of Antigen 77 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11309
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Xenopus: 85%; Chicken: 85%; Zebrafish: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.