Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLITRK6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16242520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16242520 20 μL
NBP162425 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16242520 Supplier Novus Biologicals Supplier No. NBP16242520UL

Rabbit Polyclonal Antibody

SLITRK6 Polyclonal specifically detects SLITRK6 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLITRK6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H5Y7
Gene Alias FLJ22774, MGC119595, MGC119596, MGC119597,4832410J21Rik, SLIT and NTRK-like family, member 6, SLIT and NTRK-like protein 6, slit and trk like gene 6
Gene Symbols SLITRK6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLITRK6(SLIT and NTRK-like family, member 6) The peptide sequence was selected from the N terminal of SLITRK6. Peptide sequence NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL.
Molecular Weight of Antigen 95 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84189
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.