SMARCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431161	Novus Biologicals NBP18871925UL	25 μL
NBP188719	Novus Biologicals NBP188719	0.1 mL

Description

SMARCD1 Polyclonal specifically detects SMARCD1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SMARCD1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Chromatin Research
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 6602
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: BAF60Amammalian chromatin remodeling complex BRG1-associated factor 60A, BRG1-associated factor 60A, chromatin remodeling complex BAF60A subunit, CRACD1, Rsc6p, subfamily d, member 1, SWI/SNF complex 60 kDa subunit, SWI/SNF complex 60 kDa subunit A, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 1,60 kDa BRG-1/Brm-associated factor subunit A, Swp73-like protein
• Gene Symbols: SMARCD1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only