SMC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152932

Catalog No. NBP152932

Description

SMC2 Polyclonal specifically detects SMC2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SMC2
• Immunogen: Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
• Gene ID (Entrez): 10592
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CAP-E, CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast), Chromosome-associated protein E, FLJ10093, hCAP-EXCAP-E homolog, SMC protein 2, SMC-2, SMC2 (structural maintenance of chromosomes 2, yeast)-like 1, SMC2 structural maintenance of chromosomes 2-like 1, SMC2L1, structural maintenance of chromosomes (SMC) family member, structural maintenance of chromosomes 2, structural maintenance of chromosomes protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG