Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMC2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen SMC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP152932
SDP
View Documents
Novus Biologicals
NBP152932
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

SMC2 Polyclonal specifically detects SMC2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SMC2
Polyclonal
Rabbit
Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
10592
Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE.
Primary
Western Blot
Unconjugated
RUO
CAP-E, CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast), Chromosome-associated protein E, FLJ10093, hCAP-EXCAP-E homolog, SMC protein 2, SMC-2, SMC2 (structural maintenance of chromosomes 2, yeast)-like 1, SMC2 structural maintenance of chromosomes 2-like 1, SMC2L1, structural maintenance of chromosomes (SMC) family member, structural maintenance of chromosomes 2, structural maintenance of chromosomes protein 2
SMC2
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.