Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMCHD1 Antibody (CL4265), Novus Biologicals™
SDP

Catalog No. NB393155 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393155 25 μL
NBP259045 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393155 Supplier Novus Biologicals Supplier No. NBP25904525UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

SMCHD1 Monoclonal specifically detects SMCHD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SMCHD1
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias DKFZp686O0631, KIAA0650, structural maintenance of chromosomes flexible hinge domain containing 1, structural maintenance of chromosomes flexible hinge domain-containing protein 1
Gene Symbols SMCHD1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 23347
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.