SMCHD1 Antibody (CL4265), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259045

Catalog No. NBP259045

Description

SMCHD1 Monoclonal specifically detects SMCHD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SMCHD1
• Classification: Monoclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DKFZp686O0631, KIAA0650, structural maintenance of chromosomes flexible hinge domain containing 1, structural maintenance of chromosomes flexible hinge domain-containing protein 1
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SMCHD1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 23347
• Target Species: Human
• Form: Purified

For Research Use Only