Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMG5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15677820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15677820 20 μL
NBP156778 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15677820 Supplier Novus Biologicals Supplier No. NBP15677820UL

Rabbit Polyclonal Antibody

SMG5 Polyclonal specifically detects SMG5 in Human samples. It is validated for Western Blot.

Specifications

Antigen SMG5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UPR3
Gene Alias EST1BFLJ12287, EST1-like protein B, Est1p-like protein B, ever shorter telomeres 1B, hSMG-5, KIAA1089FLJ34864, LPTS interacting protein, LPTS-interacting protein, LPTSRP1, LPTS-RP1EST1 telomerase component homolog B, protein SMG5, RP11-54H19.7, SMG-5, SMG-5 homolog, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)
Gene Symbols SMG5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SMG5(Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)) The peptide sequence was selected from the N terminal of SMG5. Peptide sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 23381
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.