Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMG5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00
Specifications
| Antigen | SMG5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15677820
|
Novus Biologicals
NBP15677820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156778
|
Novus Biologicals
NBP156778 |
100 μL | N/A | N/A | N/A | ||||
Description
SMG5 Polyclonal specifically detects SMG5 in Human samples. It is validated for Western Blot.Specifications
| SMG5 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| EST1BFLJ12287, EST1-like protein B, Est1p-like protein B, ever shorter telomeres 1B, hSMG-5, KIAA1089FLJ34864, LPTS interacting protein, LPTS-interacting protein, LPTSRP1, LPTS-RP1EST1 telomerase component homolog B, protein SMG5, RP11-54H19.7, SMG-5, SMG-5 homolog, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans) | |
| SMG5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UPR3 | |
| 23381 | |
| Synthetic peptides corresponding to SMG5(Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)) The peptide sequence was selected from the N terminal of SMG5. Peptide sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title