Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SMYD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SMYD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123461 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123461 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB123461 Supplier Novus Biologicals Supplier No. NBP309280100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SMYD2 Polyclonal specifically detects SMYD2 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

Antigen SMYD2
Applications ChIP Assay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Formulation PBS buffer, 2% sucrose
Gene Alias EC 2.1.1.43, Histone methyltransferase SMYD2, HSKM-Bzinc finger, MYND domain containing 14, KMT3CEC 2.1.1.-, Lysine N-methyltransferase 3C, MGC119305, SET and MYND domain containing 2, SET and MYND domain-containing protein 2, ZMYND14
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SMYD2 (NP_064582). Peptide sequence SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56950
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.