Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18029620UL
Description
SNAP43 Polyclonal specifically detects SNAP43 in Human samples. It is validated for Western Blot.Specifications
SNAP43 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_003073 | |
SNAPC1 | |
Synthetic peptide directed towards the C terminal of human SNAPC1. Peptide sequence GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVIT. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Proximal sequence element-binding transcription factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, small nuclear RNA activating complex, polypeptide 1, 43kD, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, SNAP43SNAPc 43 kDa subunit, SNAPc subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1 | |
Rabbit | |
Protein A purified | |
RUO | |
6617 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction