Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SNAP45 Antibody, Novus Biologicals™

SNAP45 Antibody, Novus Biologicals™
SDP

Catalog No. NB392771 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392771 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392771 Supplier Novus Biologicals Supplier No. NBP26904725UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SNAP45 Polyclonal antibody specifically detects SNAP45 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen SNAP45
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Small nuclear RNA-activating complex polypeptide 2, SNAP45snRNA-activating protein complex 45 kDa subunit, SNAPc 45 kDa subunit, SNAPc subunit 2, snRNA-activating protein complex subunit 2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6618
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.