Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25574625UL
Description
SNAP45 Polyclonal specifically detects SNAP45 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SNAP45 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Small nuclear RNA-activating complex polypeptide 2, SNAP45snRNA-activating protein complex 45 kDa subunit, SNAPc 45 kDa subunit, SNAPc subunit 2, snRNA-activating protein complex subunit 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
6618 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SNAPC2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALVEHMTETYLRLTAPQPIPAGGSLGPAAEGDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction