SNAPC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25771325UL

Catalog No. NB393815

Description

SNAPC3 Polyclonal specifically detects SNAPC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SNAPC3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: MGC132011, MGC33124, Proximal sequence element-binding transcription factor subunit beta, PSE-binding factor subunit beta, PTF subunit beta, PTFbeta, small nuclear RNA activating complex, polypeptide 3, 50kD, small nuclear RNA activating complex, polypeptide 3, 50kDa, Small nuclear RNA-activating complex polypeptide 3, SNAP50SNAPc 50 kDa subunit, SNAPc subunit 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6619
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SNAPC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only