SNRP70 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23789625UL

Catalog No. NB404698

Description

SNRP70 Polyclonal specifically detects SNRP70 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNRP70
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P08621
• Gene Symbols: SNRNP70
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human SNRP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6625
• Target Species: Human
• Isotype: IgG